PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G163400.1
Common NameB456_007G163400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 383aa    MW: 42336.9 Da    PI: 5.9255
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G163400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.2e-3190144155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWt eLH+ Fv+av++LGG++kAtPktil+lm+++gL l+hvkSHLQk+Rl
  Gorai.007G163400.1  90 KPRLRWTYELHAYFVDAVNKLGGPQKATPKTILDLMDLDGLNLYHVKSHLQKFRL 144
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.12187147IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2788144IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-2290145IPR006447Myb domain, plants
SuperFamilySSF466896.81E-1590144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MMENNVVNQN PGEFKRTEKG KEAVAGHEGD VNGDNQGDHH QIQGGGHNTL LALQETQGPS  60
IPVEINDDQV VNNEVVVKEK PILMVTNEIK PRLRWTYELH AYFVDAVNKL GGPQKATPKT  120
ILDLMDLDGL NLYHVKSHLQ KFRLGKFWVK EWQDTSKNVS QQQGGARSLR ALNSPSQNKE  180
PNRRAKAKRN RGPKNEPRGR LYMQLQAQKH FLWYMESQRT NLNTALANHH LGGAATGNAF  240
PYGQGQSSSG LGTFATMPGP SDFGTVAASP QFYVNQQNAC PPTYDAPTGQ ANPCLQEVPP  300
SGHQPQTSLY PAPESLSTPN GYPASSYQET SPVLPGSETE DEDLIEALLN WEDNEPINLD  360
ASFNFDNLHG CINYNDLQDW LK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181188NRRAKAKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490983.10.0PREDICTED: myb family transcription factor APL-like isoform X1
TrEMBLA0A0D2QTW80.0A0A0D2QTW8_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2209123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.18e-33G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]